125785
DFF45 (DNA Fragmentation Factor Subunit alpha, DNA Fragmentation Factor 45kD Subunit, DFF-45, Inhibitor of CAD, ICAD, DFFA, DFF1, H13)
Größe
£685.00
- SKU:
- 125785
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa231-331 from human DFFA (NP_004392.1) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3A11
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Apoptosis is related to many diseases and induced by a family of cell death receptors and their ligands. Cell death signals are transduced by death domain containing adapter molecules and members of the caspase family of proteases. These death signals finally cause the degradation of chromosomal DNA by activated DNase. A human DNA fragmentation factor (DFF) was identified recently which was cleaved by caspase-3 during apoptosis. A mouse homologue of human DFF was identified as a DNase inhibitor and designated ICAD. Upon cleavage of DFF/ICAD, a caspase activated deoxyribonuclease (CAD) is released and activated and eventually causes the degradation of DNA in the nuclei. Therefore, the cleavage of CAD inhibitor molecule DFF/ICAD, which causes DNase activation and DNA degradation, is the hallmark of apoptotic cell death. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: TSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACERELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice