125720-PE

DDT (D-dopachrome Decarboxylase, D-dopachrome Tautomerase, Phenylpyruvate Tautomerase II) (PE)

Größe

£914.00

SKU:: 125720-PE
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-118 from human DDT (AAH05971) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1G1
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Weitere Details:: Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI). Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich FLISA: The detection limit is ~3ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.