DDIT4L (REDD2, RTP801L, DNA Damage-inducible Transcript 4-like Protein, HIF-1 Responsive Protein RTP801-like, Protein Regulated in Development and DNA Damage Response 2)

Größe

£685.00

SKU:: 125710
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa94-194 from human DDIT4L (NP_660287) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2E6
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: DDIT4L inhibits cell growth by regulating the FRAP1 pathway upstream of the TSC1-TSC2 complex and downstream of AKT1. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVFKQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.