DDB2 (DNA Damage-binding Protein 2, DDB p48 Subunit, DDBb, Damage-specific DNA-binding Protein 2, UV-damaged DNA-binding Protein 2, UV-DDB 2)

Größe

£685.00

SKU:: 125702
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-109 from human DDB2 (AAH00093) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1F11
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: DDB2 is required for expression of an ultraviolet radiation (UV)-damaged DNA-binding activity and is disrupted by mutations in the subset of xeroderma pigmentosum group E cells that lack this activity, DDB-negative XPE. DDB2 is the smaller subunit of a heterodimeric protein implicated in the etiology of xeroderma pigmentosum group E. This subunit appears to be required for DNA binding. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.