125700-BIOTIN
DDB1 (DNA Damage-binding Protein 1, DDB p127 Subunit, DNA Damage-binding Protein a, DDBa, Damage-specific DNA-binding Protein 1, HBV X-associated Protein 1, XAP-1, UV-damaged DNA-binding Factor, UV-damaged DNA-binding Protein 1, UV-DDB 1, XPE-binding Factor, XPE-BF, Xeroderma pigmentosum Group E-complementing Protein, XPCe, XAP1) (Biotin)
Größe
£927.00
- SKU:
- 125700-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1044-1140 from human DDB1 (NP_001914) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4C5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- DNA damage binding protein (DDB) is a heterodimer that functions in DNA repair, and is associated with the DNA repair deficiency disease xeroderma pigmentosum (XP). The damaged DNA binding function of DDB requires both DDB1 (p125, 127kD) and DDB2 (p48, 48kD) subunits. When the subunits of DDB are expressed individually, p48 localized in the nucleus and p125 localized in the cytoplasm. Co-expression of p125 with p48 resulted in an increased accumulation of p125 in the nucleus, indicating that p48 plays a critical role in the nuclear localization of p125. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Sandwich ELISA (Recombinant protein): The detection limit is ~0.3ng/ml as a capture antibody. Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml stains DDB1 on human adrenal gland. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice