125668-HRP
DCLK2 (Serine/Threonine-protein Kinase DCLK2, Doublecortin-like And CAM Kinase-like 2, Doublecortin-like Kinase 2, Doublecortin Domain-containing Protein 3B, CaMK-like CREB Regulatory Kinase 2, CLICK-II, CL2, DCAMKL2, DCDC3B, DCK2) (HRP)
Größe
£914.00
- SKU:
- 125668-HRP
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa348-438 from human DCAMKL2 (AAH32726) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2A5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Weitere Details:
- DCAMKL2 is a protein kinase containing an N-terminal doublecortin domain highly homologous to DCX, a microtubule-associated protein with essential participation in the development of the mammalian cerebral cortex. As with other DCAMKL family members, DCAMKL2 possesses microtubule binding activity and, together with DCX, is thought to form a signaling pathway that regulates microtubules in migrating neurons. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FRGLKISAHGRSSSNVNGGPELDRCISPEGVNGNRCSESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAKCCGKEHLIE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice