125660-BIOTIN
DCBLD2 (CLCP1, ESDN, Discoidin, CUB and LCCL Domain-containing Protein 2, CUB, LCCL and Coagulation Factor V/VIII-homology Domains Protein 1, Endothelial and Smooth Muscle Cell-derived Neuropilin-like Protein) (Biotin)
Größe
£927.00
- SKU:
- 125660-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa80-165 from human DCBLD2 (NP_563615) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3G10
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- DCBLD2, otherwise known as ESDN (endothelial and smooth muscle cell-derived neuropilin-like molecule) is a novel type-I transmembrane protein with the longest cleavable secretory signal sequence among eukaryotes. It is expressed in various tissues; particularly highly expressed in cultured vascular smooth muscle cells. DCBLD2 is considered to play a role in regulation of vascular cell growth and may have a wide variety of functions in other tissues including the nervous system, like neuropilins. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice