DBF4 (Protein DBF4 Homolog A, Activator of S Phase Kinase, DBF4-type Zinc Finger-containing Protein 1, Chiffon Homolog A, ASK, DBF4A, ZDBF1)

Größe

£685.00

SKU:: 125648
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2-99 from human DBF4 (NP_006707) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6G9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: ASK is a regulatory subunit for CDC7 which activates its kinase activity thereby playing a central role in DNA replication and cell proliferation. It is required for progression of S phase. The complex CDC7-DBF4A selectively phosphorylates MCM2 subunit at 'Ser-40' and 'Ser-53' and then is involved in regulating the initiation of DNA replication during cell cycle. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: NSGAMRIHSKGHFQGGIQVKNEKNRPSLKSLKTDNRPEKSKCKPLWGKVFYLDLPSVTISEKLQKDIKDLGGRVEEFLSKDISYLISNKKEAKFAQT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.