Cystatin C (Cystatin-C, Cystatin-3, Gamma-trace, Neuroendocrine Basic Polypeptide, Post-gamma-globulin, CST3)

Größe

£760.00

SKU:: 125608
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full length human CST3, aa1-146 (NP_000090.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: A non-glycosylated secreted protein and member of the type 2 cystatin superfamily, which acts as a potent inhibitor of both endogenous and pathogenic cysteine proteinases. Cystatin C is produced by nucleated cells and is present in a variety of biological fluids. Changes in cystatin C have been associated with a number of cardiovascular diseases, including atherosclerosis and myocardial infarction, and measurement of plasma cystatin C levels can be used as a more sensitive marker than creatinine for determining glomerular filtration rate (GFR) in the kidneys. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.