125580
CYP2E1 (P450IIE1, Cytochrome P450, Family 2, Subfamily E, Polypeptide 1, 4-nitrophenol 2-hydroxylase, CPE1, CYP2E, CYPIIE1, Cytochrome P450 2E1, Cytochrome P450-J, P450C2E, P450-J)
Größe
£760.00
- SKU:
- 125580
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length recombinant protein corresponding to aa1-493 of human CYP2E1.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- P450IIE1, also known as CYP2E1, is a member of the P450IIE subfamily which is ethanol-inducible. It has 1 gene which is mapped to 10q24.3-qter, and a second in rat and in man. Both the rat and human proteins encoded by this gene contain 493aa and calculated molecular masses of 56,634 and 56,916 daltons, respectively. In addition, genetic polymorphisms in the 5-prime flanking region of the human P450IIE1 gene affect its binding of transacting factor and change its transcriptional regulation, which may lead to interindividual differences of microsomal drug oxidation activity. P450IIE1 is an important enzyme for the catalysis of the conversion of ethanol to acetaldehyde and to acetate in humans, and it is also involved in the metabolism of nitrosamines. Due to the possible correlation of P450IIE1 genes with malignancy, clinical studies of RFLP patterns of these genes in cancer may be useful. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRLAQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVIPRS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice