CYLD (Ubiquitin Carboxyl-terminal Hydrolase CYLD, Deubiquitinating Enzyme CYLD, Ubiquitin Thiolesterase CYLD, Ubiquitin-specific-processing Protease CYLD, CYLD1, KIAA0849, HSPC057)

Größe

£685.00

SKU:: 125552
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa854-953 from human CYLD (AAH12342) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2C3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: CYLD is a 956aa, cytoplasmic, deubiquitinating enzyme belonging to the ubiquitin carboxy-terminal hydrolases (UCH) family of proteins with three cytoskeletal-associated protein-glycine-conserved (CAP-GLY) domains, a proline rich region, a SH3 binding domain and a sequence homology to catalytic domain of UCH. CYLD is identified as a tumor suppressor protein affecting the JNK signaling pathway. CYLD is a negative regulator of TRAF2 and NF-kappa-B signaling pathway and is also known to have receptor-dependent role in regulating the I-kappa-B kinase pathway. It also has a deubiquitinating activity that is directed towards non-Lys-48-linked polyubiquitin chains and TRAP1 is a novel substrate for deubiquitination. Mutated CYLD is known to be associated with cylindromatosis, multiple familial trichoepithelioma, and Brooke-Spiegler syndrome. Applications: Suitable for use in Immunofluorescence and ELISA. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: QNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice