125552-FITC
CYLD (Ubiquitin Carboxyl-terminal Hydrolase CYLD, Deubiquitinating Enzyme CYLD, Ubiquitin Thiolesterase CYLD, Ubiquitin-specific-processing Protease CYLD, CYLD1, KIAA0849, HSPC057) (FITC)
Größe
£914.00
- SKU:
- 125552-FITC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa854-953 from human CYLD (AAH12342) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2C3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Weitere Details:
- CYLD is a 956aa, cytoplasmic, deubiquitinating enzyme belonging to the ubiquitin carboxy-terminal hydrolases (UCH) family of proteins with three cytoskeletal-associated protein-glycine-conserved (CAP-GLY) domains, a proline rich region, a SH3 binding domain and a sequence homology to catalytic domain of UCH. CYLD is identified as a tumor suppressor protein affecting the JNK signaling pathway. CYLD is a negative regulator of TRAF2 and NF-kappa-B signaling pathway and is also known to have receptor-dependent role in regulating the I-kappa-B kinase pathway. It also has a deubiquitinating activity that is directed towards non-Lys-48-linked polyubiquitin chains and TRAP1 is a novel substrate for deubiquitination. Mutated CYLD is known to be associated with cylindromatosis, multiple familial trichoepithelioma, and Brooke-Spiegler syndrome. Applications: Suitable for use in Immunofluorescence and FLISA. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: QNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice