CYLC1 (Cylicin-1, Cylicin I, Multiple-band Polypeptide I, CYL, CYL1)

Größe

£685.00

SKU:: 125551
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa526-625 from human CYLC1 (XP_088636.6) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6F12
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Possible architectural role during spermatogenesis. May be involved in spermatid differentiation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SSKTGFKTSTKIKGSDTESEESLYKPGAKKKIDESDGTSANSKMEGLESKRGFRMSSKKTTFNEKGEKASTGRVPPSREKPPLPACEPSLPSPKVRRLCW Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.