125539
Cyclin D2 (CCND2, G1/S-specific Cyclin-D2, KIAK0002, MGC102758)
Größe
£685.00
- SKU:
- 125539
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa190-289 from human CCND2 (AAH10958) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3B10
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Cyclins are proteins that regulate cell cycle progression by interacting with cdc2 kinase or related kinases. Human cyclins have been grouped into 5 types, A through E, based largely upon sequence similarity. The D-type cyclins (D1, D2, and D3) are a family of cell cycle regulators involved in the G1/S phase transition of the cell cycle. On binding to cyclin-dependent kinases CDK4 or CDK6 and activation by a CDK-activating kinase complex, the cyclin-CDK complex activates numerous genes involved in DNA synthesis and cell cycle progression. Cyclin D2 a G1 cyclin, is a member of the family of D-type cyclins. Indirect immunofluorescence studies showed that the protein is localized to the nucleus in G0, suggesting a nuclear function for cyclin D2 in quiescent cells. It is found to be associated with the cyclin-dependent kinases, CDK2 and CDK4 and thus mediates the phosphorylation of tumor suppressor protein Rb during growth arrest. Knockout studies of the homologous gene in mouse suggest the essential roles of this gene in ovarian granulosa and germ cell proliferation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice