CYB5R3 (NADH-cytochrome b5 Reductase 3, B5R, Cytochrome b5 Reductase, Diaphorase-1, DIA1)

Größe

£685.00

SKU:: 125528
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa157-252 from human CYB5R3 (AAH04821.1) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2A9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is 1ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: FAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.