CXCL5 (C-X-C Motif Chemokine 5, ENA-78 (1-78), Epithelial-derived Neutrophil-activating Protein 78, Neutrophil-activating Peptide ENA-78, Small-inducible Cytokine B5, ENA78, SCYB5)

Größe

£685.00

SKU:: 125507
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-115 from human CXCL5 (AAH08376) with GST tag. MW of the GST tag alone is 26kD.
Klon:: M1
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Cross-desensitization experiments indicate that ENA-78 acts through the same type of receptors as IL-8, NAP-2, and GRO alpha. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.