CXCL16 (C-X-C Motif Chemokine 16, Scavenger Receptor for Phosphatidylserine and Oxidized Low Density Lipoprotein, SR-PSOX, Small-inducible Cytokine B16, Transmembrane Chemokine CXCL16, SRPSOX)

Größe

£685.00

SKU:: 125504
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant protein corresponding to aa49-273 from human CXCL16 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B12
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: CXCL16 is a transmembrane protein with an extracellular domain consisting of a chemokine domain suspended on a mucin-like stalk. It functions as a ligand for the HIV co-receptor, CXCR6 (Bonzo). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: NEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPVAPDSNT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.