CXCL13 (C-X-C Motif Chemokine 13, Angie, B cell-attracting Chemokine 1, BCA-1, B Lymphocyte Chemoattractant, CXC Chemokine BLC, Small-inducible Cytokine B13, BCA1, BLC, SCYB13)

Größe

£760.00

SKU:: 125503
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full-length human CXCL13, aa1-189 (NP_006410.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.