125501-PE
CXCL12 (SDF-1-alpha, Stromal Cell-derived Factor 1, hSDF-1, C-X-C Motif Chemokine 12, Intercrine Reduced in Hepatomas, IRH, hIRH, Pre-B Cell Growth-stimulating Factor, PBSF, SDF1, SDF1A) (PE)
Größe
£914.00
- SKU:
- 125501-PE
- Anwendung:
- FLISA
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant protein corresponding to aa1-89 from human CXCL12 (AAH39893) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1E5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Weitere Details:
- CXCL12, also known as pre-B-cell growth-stimulating factor (PBSF) or stromal cell-derived factor-a (SDF-1a), is a 70aa CXC chemokine originally cloned from a bone marrow stromal cell line. Targeted deletion of CXCL12 gene resulted in defects of B-cell lymphopoiesis and bone marrow myelopoiesis. CXCL12 has been shown to be chemotactic for lymphocytes. In addition, CXCL12 was recently reported to be a ligand for CXCR4 (LESTR/fusin), a co-receptor for HIV-1 entry into T cells. CXCL12 binding to CXCR4 inhibits HIV-1 entry. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice