125493
CX3CR1 (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28)
Größe
£685.00
- SKU:
- 125493
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-36 from human CX3CR1 (AAH28078) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2B11
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- Human CX3CR1 has been shown to mediate both the adhesive and migratory functions of fractalkine. Fractalkine and CX 3 CR1 represent new types of leukocyte trafficking regulators. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice