125491
CX3CL1 (Fractalkine, C-X3-C Motif Chemokine 1, CX3C Membrane-anchored Chemokine, Neurotactin, Small-inducible Cytokine D1, FKN, NTT, SCYD1, A-152E5.2)
Größe
£685.00
- SKU:
- 125491
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa26-136 from human CX3CL1 (AAH01163) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1D6
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Fractalkine, also known as neurotactin, is a membrane-bound CX3C Chemokine. The mature protein is part of a 397aa precursor and consists of a chemokine domain of 76aa, a mucin stalk of 241aa, a putative transmembrane domain of 18aa, and an intracellular tail of 37aa. Within the chemokine domain, the first two cysteine residues are separated by 3aa (CX3C). Fractalkine message is found in high abundance in the brain, kidney, lung and heart tissues. Fractalkine is chemotactic for monocytes and other leukocytes including NK cells and may play a role in brain inflammation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGES Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice