125491-ML550
CX3CL1 (Fractalkine, C-X3-C Motif Chemokine 1, CX3C Membrane-anchored Chemokine, Neurotactin, Small-inducible Cytokine D1, FKN, NTT, SCYD1, A-152E5.2) (MaxLight 550)
Größe
£914.00
- SKU:
- 125491-ML550
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa26-136 from human CX3CL1 (AAH01163) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1D6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Weitere Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. Fractalkine, also known as neurotactin, is a membrane-bound CX3C Chemokine. The mature protein is part of a 397aa precursor and consists of a chemokine domain of 76aa, a mucin stalk of 241aa, a putative transmembrane domain of 18aa, and an intracellular tail of 37aa. Within the chemokine domain, the first two cysteine residues are separated by 3aa (CX3C). Fractalkine message is found in high abundance in the brain, kidney, lung and heart tissues. Fractalkine is chemotactic for monocytes and other leukocytes including NK cells and may play a role in brain inflammation. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGES Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice