125482
Cullin 3 (Cullin-3, CUL3, CUL-3, KIAA0617)
Größe
£685.00
- SKU:
- 125482
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa301-400 from CUL3 (AAH39598) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1A3
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Cullins are scaffold proteins in the E3 ligase complex and forms a catalytic core complex with Roc1/Rbx1/Hrt1, with Roc1 recruiting a cognate E2 enzyme. They are major components of SCF complexes, and have been implicated in degradation of key regulatory molecules including Cyclin E, beta-catenin and Cubitus interruptus. Six Cul protein members have been identified in mammals: Cul1, Cul2, Cul3, Cul4A, Cul4B, and Cul5. Cullin 3 forms a tight complex with cyclin E and is involved in its ubiquitination, thus regulates G1/S transition. It is also involved in ubiquitination of both BMI1/PCGF4 and H2AFY, in complex with SPOP. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLLESFNNDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice