125482-BIOTIN
Cullin 3 (Cullin-3, CUL3, CUL-3, KIAA0617) (Biotin)
Größe
£927.00
- SKU:
- 125482-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa301-400 from CUL3 (AAH39598) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1A3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Cullins are scaffold proteins in the E3 ligase complex and forms a catalytic core complex with Roc1/Rbx1/Hrt1, with Roc1 recruiting a cognate E2 enzyme. They are major components of SCF complexes, and have been implicated in degradation of key regulatory molecules including Cyclin E, beta-catenin and Cubitus interruptus. Six Cul protein members have been identified in mammals: Cul1, Cul2, Cul3, Cul4A, Cul4B, and Cul5. Cullin 3 forms a tight complex with cyclin E and is involved in its ubiquitination, thus regulates G1/S transition. It is also involved in ubiquitination of both BMI1/PCGF4 and H2AFY, in complex with SPOP. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLLESFNNDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGV Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice