125459-ML490
CTNND2 (Catenin delta-2, Delta-catenin, GT24, Neural Plakophilin-related ARM-repeat Protein, NPRAP, Neurojungin, NPRAP) (MaxLight 490)
Größe
£914.00
- SKU:
- 125459-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1081-1190 from human CTNND2 (NP_001323) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 6E11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Catenin delta-2 functions as a transcriptional activator when bound to ZBTB33. It may also be involved in neuronal cell adhesion and tissue morphogenesis and integrity by regulating adhesion molecules. It is predominantly expressed in the brain and localises to the nucleus and cell junction. The unprocessed precursor has a length of 1225aa and a predicted molecular weight of 132.7kD. This protein is O-glycosylated. It is also phosporylated upon DNA damage. It belongs to the beta-catenin family and contains nine ARM repeats. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLYRNSYGAPAEDIKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLG Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice