CTHRC1 (Protein NMTC1, Collagen Triple Helix Repeat-containing Protein 1, UNQ762/PRO1550)

Größe

£685.00

SKU:: 125444
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa32-141 from human CTHRC1 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1G12
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: CTHRC1 may act as a negative regulator of collagen matrix deposition (By similarity). Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications have not tested. Recommended Dilutions: Immunohistochemistry (FFPE): 3ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: EIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.