125444-BIOTIN

CTHRC1 (Protein NMTC1, Collagen Triple Helix Repeat-containing Protein 1, UNQ762/PRO1550) (Biotin)

Größe

£927.00

SKU:: 125444-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa32-141 from human CTHRC1 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1G12
Format:: Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Biotin.
Weitere Details:: CTHRC1 may act as a negative regulator of collagen matrix deposition (By similarity). Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunohistochemistry: Formalin-fixed, paraffin-embedded sections Optimal dilutions to be determined by the researcher. Amino Acid Sequence: EIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLF Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.