125388-HRP
CSE1L (Chromosome Segregation 1-like Protein, Cellular Apoptosis Susceptibility Protein, CAS, CSE1, Exportin-2, Exp2, Importin-alpha Re-exporter, XPO2) (HRP)
Größe
£914.00
- SKU:
- 125388-HRP
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa872-971 from human CSE1L (NP_001307) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2C10
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Weitere Details:
- Cellular Apoptosis Susceptibility (CAS) protein is asso- ciated with microtubules and the mitotic spindle. The correlation with cell proliferation and apoptosis are yet to be fully determined but the protein may be involved with development of certain leukemias and lymphomas. High expression has been reported to correspond with proliferation of normal and malignant lymphoid cells. This antibody with help detect CAS protein and further elucidate its role in cellular apoptosis. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAASVTLL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice