CRSP8 (P37 TRAP/SMCC/PC2 Subunit, Transcriptional Coactivator CRSP34, CRSP Complex Subunit 8, Cofactor Required For Sp1 Transcriptional Activation Subunit 8, Mediator Complex Subunit 27, Mediator Of RNA Polymerase II Transcription Subunit 27, MED27, CRSP34)

Größe

£685.00

SKU:: 125354
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-70 from CRSP8 (AAH02878) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 8B8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. CRSP8 is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Applications: Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 0.3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice