125336
CRIM1 (Cysteine-rich Motor Neuron 1 Protein, CRIM-1, Cysteine-rich Repeat-containing Protein S52, S52, UNQ1886/PRO4330, MGC138194)
Größe
£685.00
- SKU:
- 125336
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa36-146 from human CRIM1 (NP_057525) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 6E4
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- CRIM1 may participate in CNS development by interacting with growth factors involved in motor neuron differentiation and survival. It also has a potential role in capillary formation and maintenance during angiogenesis. It also affects BMP processing and delivery to the cell surface. CRIM1 interacts with BMP4 and BMP7. It localises to the cell membrane and is expressed in a number of tissues including the pancreas, kidney, skeletal muscle, lung, placenta, brain, heart, spleen, liver, small intestine and blood vessels. The unprocessed precursor has a length of 1036 amino acids and a predicted molecular weight of 113.7kD. CRIM1 contains four antistatin-like domains, one IGFBP N-terminal domain and six VWFC domains. It is also N-glycosylated. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: VCLPCDESKCEEPRNCPGSIVQGVCGCCYTCASQRNESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice