125336-ML490
CRIM1 (Cysteine-rich Motor Neuron 1 Protein, CRIM-1, Cysteine-rich Repeat-containing Protein S52, S52, UNQ1886/PRO4330, MGC138194) (MaxLight 490)
Größe
£914.00
- SKU:
- 125336-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa36-146 from human CRIM1 (NP_057525) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 6E4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. CRIM1 may participate in CNS development by interacting with growth factors involved in motor neuron differentiation and survival. It also has a potential role in capillary formation and maintenance during angiogenesis. It also affects BMP processing and delivery to the cell surface. CRIM1 interacts with BMP4 and BMP7. It localises to the cell membrane and is expressed in a number of tissues including the pancreas, kidney, skeletal muscle, lung, placenta, brain, heart, spleen, liver, small intestine and blood vessels. The unprocessed precursor has a length of 1036 amino acids and a predicted molecular weight of 113.7kD. CRIM1 contains four antistatin-like domains, one IGFBP N-terminal domain and six VWFC domains. It is also N-glycosylated. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: VCLPCDESKCEEPRNCPGSIVQGVCGCCYTCASQRNESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTI Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice