CRELD2 (Cysteine-rich with EGF-like Domain Protein 2, UNQ185/PRO211, DKFZp667O055, MGC11256)

Größe

£698.00

SKU:: 125326
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa163-259 from human CRELD2 (NP_077300) with GST tag.
Klon:: 2B6
Format:: Supplied as a liquid in ascites fluid.
Weitere Details:: CRELD2 may regulate transport of alpha4-beta2 neuronal acetylcholine receptor. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEVGWVLDEGACVDVDECAAEPPPCSAAQFCKNANGSYTCEE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.