CREB3L4 (AIBZIP, Cyclic AMP-responsive Element-binding Protein 3-like Protein 4, cAMP-responsive Element-binding Protein 3-like Protein 4, Androgen-induced Basic Leucine Zipper Protein, AIbZIP, Attaching to CRE-like 1, ATCE1, Cyclic AMP-responsive Element-binding Protein 4, CREB-4, cAMP-responsive Element-binding Protein 4, Transcript Induced in Spermiogenesis Protein 40, Tisp40, hJAL, CREB4, JAL)

Größe

£685.00

SKU:: 125317
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1-111 from human CREB3L4 (NP_570968) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3E3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Androgen-induced basic leucine zipper (AIBZIP)is a transcription factor. AIbZIP is a 395aa protein with homology to cyclic AMP-responsive element binding protein/activating transcription factor. It contains an NH(2)-terminal activation domain, a central bZIP domain, and a COOH-terminal transmembrane domain. Immunoreactive AIbZIP protein has been detected in the cytoplasm of prostatic luminal epithelial cells; full-length AIbZIP-GFP fusion proteins are localized in the cytoplasm of LNCaP cells, while a truncated form of AIbZIP lacking the putative transmembrane domain was exclusively nuclear. AIbZIP is expressed at higher levels in cancerous prostate cells compared with noncancerous prostate cells. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGLQESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice