CPSF6 (CFIM68, Cleavage and Polyadenylation Specificity Factor Subunit 6, Cleavage and Polyadenylation Specificity Factor 68kD Subunit, Pre-mRNA Cleavage Factor Im 68kD Subunit, Protein HPBRII-4/7)

Größe

£685.00

SKU:: 125295
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa37-137 from human CPSF6 (NP_008938) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3F11
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Component of the cleavage factor Im complex (CFIm) that plays a key role in pre-mRNA 3'-processing. Involved in association with NUDT21/CPSF5 in pre-MRNA 3'-end poly(A) site cleavage and poly(A) addition. CPSF6 binds to cleavage and polyadenylation RNA substrates and promotes RNA looping. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: ISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEAS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.