CPA4 (Carboxypeptidase A4, Carboxypeptidase A3, UNQ694/PRO1339, CPA3)

Größe

£685.00

SKU:: 125271
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa260-362 from human CPA4 (NP_057436) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1F4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: CPA4 is a member of the carboxypeptidase A/B subfamily. Carboxypeptidases are zinc-containing exopeptidases that catalyze the release of carboxy-terminal amino acids, and are synthesized as zymogens that are activated by proteolytic cleavage. This protein could be involved in the histone hyperacetylation pathway. It is imprinted and may be a strong candidate protein for prostate cancer aggressiveness. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NASFAGKGASDNPCSEVYHGPHANSEVEVKSVVDFIQKHGNFKGFIDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKALASVSGTEYQVGPTCTTVYP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.