125239
CORO1C (Coronin 3, Coronin-1C, Coronin-3, hCRNN4, CRNN4)
Größe
£685.00
- SKU:
- 125239
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa375-474 from CORO1C (NP_055140) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1F7
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Coronin 3 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40aa typically bracketed by gly-his and trp-asp (GH-WD). These may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. By similarity, Coronin 3 may be involved in cytokinesis, motility, and signal transduction. Coronin 3 is ubiquitously expressed in all human tissues, in contrast to other known coronin-like molecules, each of which is expressed in a tissue-specific manner. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: EEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIA* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice