125237-ML490
CORO1A (Coronin-1A, Coronin-like Protein A, Clipin-A, Coronin-like Protein p57, Tryptophan Aspartate-containing Coat Protein, TACO, CORO1, FLJ41407, MGC117380) (MaxLight 490)
Größe
£914.00
- SKU:
- 125237-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa360-462 from CORO1A (NP_009005) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4G10
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Coronin 1a belongs to the WD repeat coronin family and contains 5 WD repeats. It may be an essential component of the cytoskeleton of highly motile cells, with roles both in the invagination of large pieces of plasma membrane, as well as in forming protrusions of the plasma membrane involved in cell locomotion. In cell infected by mycobacteria, its retention on the phagosomal membrane prevents fusion between phagosomes and lysosomes. In the CNS, coronin 1A is expressed exclusively by microglial cells. Although its function is not entirely clear, it may act as a linkage protein between the actin cytoskeleton and the plasma membrane, and perhaps the extracellular matrix. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: QEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice