COPS2 (COP9 Signalosome Complex Subunit 2, ALIEN, COP9 Constitutive Photomorphogenic Homolog Subunit 2, CSN2, JAB1-containing Signalosome Subunit 2, Signalosome Subunit 2, SGN2, Thyroid Receptor-interacting Protein 15, TR-interacting Protein 15, TRIP 15, TRIP15, TRIP-15)

Größe

£685.00

SKU:: 125223
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa344-443 from COPS2 (NP_004227) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4B12
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Alien is a novel co-repressor that interacts with the thyroid hormone receptor in the absence of hormone. Alien is highly conserved between human and Drosophila and is specific for selected members of the nuclear hormone receptor superfamily. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: REHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.