125223-ML550
COPS2 (COP9 Signalosome Complex Subunit 2, ALIEN, COP9 Constitutive Photomorphogenic Homolog Subunit 2, CSN2, JAB1-containing Signalosome Subunit 2, Signalosome Subunit 2, SGN2, Thyroid Receptor-interacting Protein 15, TR-interacting Protein 15, TRIP 15, TRIP15, TRIP-15) (MaxLight 550)
Größe
£914.00
- SKU:
- 125223-ML550
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa344-443 from COPS2 (NP_004227) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4B12
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Weitere Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. Alien is a novel co-repressor that interacts with the thyroid hormone receptor in the absence of hormone. Alien is highly conserved between human and Drosophila and is specific for selected members of the nuclear hormone receptor superfamily. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: REHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice