125208-ML650
Complement Factor I (C3B/C4B Inactivator, CFI, IF) (MaxLight 650)
Größe
£934.00
- SKU:
- 125208-ML650
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length protein corresponding to aa1-377 from human Complement Factor I.
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Weitere Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Complement Factor I is a member of the peptidase S1 family present in the blood plasma. Factor I is an 88kD protein consisting of one polypeptide chain of 35.4kD and one of 27.6kD. Factor I is a serine protease which inactivates complement components C3b and C4b. C3b cleavage requires the presence of cofactors complement component (3b/4b) receptor 1 (CR1), membrane cofactor protein or factor H, while C4b cleavage requires complement component 4 binding protein or CR1. Factor I has no natural inhibitors. Dysfunctional factor I can lead to uncontrolled activation of the alternative complement pathway causing systemic depletion of C3 and lowering levels of factors B and H, resulting in recurrent pyogenic infections. Defects in CFI are also associated with haemolytic uraemic syndrome. Applications: Suitable for use in Western Blot. Other applications have not been tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MKLLHVFLLFLCFHLRFCKVTYTSQEDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKHGNTDSEGIVEVKLVDQDKTMFICKSSWSMREANVACLDLGFQQGADTQRRFKLSDLSINSTECLHVHCRGLETSLAECTFTKRRTMGYQDFADVVCYTQKADSPMDDFFQCVNGKYISQMKACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAGFASVAQEETEILTADMDAERRRIKSLLPKLSCGVKNRMHIRRKRIVGGKRAQLGKMKQISLDIFKGLHRVYAILEFCCIILK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice