Collapsin Response Mediator Protein 4 (CRMP-4, CRMP4, Dihydropyrimidinase-like 3, DPYSL3, Dihydropyrimidinase-related Protein 3, DRP-3, DRP3, LCRMP, TUC4, Unc-33-like Phosphoprotein, ULIP, Ulip-1)

Größe

£685.00

SKU:: 125200
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa457-555 from human DPYSL3 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1B8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: DRP-3 belongs to the hydantoinase/dihydropyrimidase subfamily. It is required for signalling by class 3 semaphorins and remodelling of the cytoskeleton. It also plays a role in axon guidance, neuronal growth cone collapse and cell migration. It exists as a homotetramer, and heterotetramer with CRMP1, DPYSL2, DPYSL4 or DPYSL5. The unprocessed precursor is 570 amino acids long and has an estimated molecular weight of 61.9kD. It is mainly expressed in heart and skeletal muscle, but is also strongly expressed in fetal brain and spinal cord. It localizes to the cytoplasm and growth cone. This protein interacts with synaptic vesicle protein 2 and SH3A domain of intersectin. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: GNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSASKR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice