125200-ML490
Collapsin Response Mediator Protein 4 (CRMP-4, CRMP4, Dihydropyrimidinase-like 3, DPYSL3, Dihydropyrimidinase-related Protein 3, DRP-3, DRP3, LCRMP, TUC4, Unc-33-like Phosphoprotein, ULIP, Ulip-1) (MaxLight 490)
Größe
£914.00
- SKU:
- 125200-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa457-555 from human DPYSL3 (NP_001378) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1B8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. DRP-3 belongs to the hydantoinase/dihydropyrimidase subfamily. It is required for signalling by class 3 semaphorins and remodelling of the cytoskeleton. It also plays a role in axon guidance, neuronal growth cone collapse and cell migration. It exists as a homotetramer, and heterotetramer with CRMP1, DPYSL2, DPYSL4 or DPYSL5. The unprocessed precursor is 570 amino acids long and has an estimated molecular weight of 61.9kD. It is mainly expressed in heart and skeletal muscle, but is also strongly expressed in fetal brain and spinal cord. It localizes to the cytoplasm and growth cone. This protein interacts with synaptic vesicle protein 2 and SH3A domain of intersectin. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: GNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSASKR Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice