125199-ML550
Collapsin Response Mediator Protein 3 (CRMP3, DPYSL4, DRP-4, ULIP4, Dihydropyrimidinase-like 4, DRP-4, Dihydropyrimidinase-relate protein 3, Collapsin response mediator protein 3, CRMP-3, UNC33-like phosphoprotein 4, CRMP3, ULIP4) (MaxLight 550)
Größe
£914.00
- SKU:
- 125199-ML550
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa461-559 from DPYSL4 (NP_006417) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1F5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Weitere Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. DRP-4 belongs to the hydantoinase/dihydropyrimidase subfamily. It is required for signalling by class 3 semaphorins and remodelling of the cytoskeleton. It also plays a role in axon guidance, neuronal growth cone collapse and cell migration. It exists as homotetramer and a heterotetramer. Antibodies against post-translationally modified DPR-4 are present in sera from patients with paraneoplastic neurological diseases. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VTPGAGRFVPRKTFPDFVYKRIKARNRLAEIHGVPRGLYDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLHQSGFSLSGSQADDHIARRTAQKIM Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice