125199-BIOTIN
Collapsin Response Mediator Protein 3 (CRMP3, DPYSL4, DRP-4, ULIP4, Dihydropyrimidinase-like 4, DRP-4, Dihydropyrimidinase-relate protein 3, Collapsin response mediator protein 3, CRMP-3, UNC33-like phosphoprotein 4, CRMP3, ULIP4) (Biotin)
Größe
£927.00
- SKU:
- 125199-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa461-559 from DPYSL4 (NP_006417) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1F5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- DRP-4 belongs to the hydantoinase/dihydropyrimidase subfamily. It is required for signalling by class 3 semaphorins and remodelling of the cytoskeleton. It also plays a role in axon guidance, neuronal growth cone collapse and cell migration. It exists as homotetramer and a heterotetramer. Antibodies against post-translationally modified DPR-4 are present in sera from patients with paraneoplastic neurological diseases. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VTPGAGRFVPRKTFPDFVYKRIKARNRLAEIHGVPRGLYDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLHQSGFSLSGSQADDHIARRTAQKIM Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice