COL4A3BP (Collagen Type IV alpha-3-binding Protein, Ceramide Transfer Protein, hCERT, Goodpasture Antigen-binding Protein, GPBP, START Domain-containing Protein 11, StARD11, StAR-related Lipid Transfer Protein 11, CERT, STARD11)

Größe

£685.00

SKU:: 125185
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa499-598 from COL4A3BP (NP_112729) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1A1
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: COL4A3BP is a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen. Goodpasture disease is the result of an autoimmune response directed at this antigen. Two transcripts exist for the gene encodign this protein. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.