125163
Cofilin 2 (Cofilin-2, Cofilin, Muscle Isoform, CFL2)
Größe
£685.00
- SKU:
- 125163
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa57-166 from human CFL2 (NP_068733) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 6G9
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Cofilin 2 is expressed in developing skeletal muscle at early fetal stages through to a young postnatal stage. During postnatal development, cofilin 1 expression in muscle is down-regulated and cofilin 2 becomes the only isoform in mature skeletal muscle. The onset of cofilin 2 expression is coupled with terminal differentiation of muscle cells. It is suggested that cofilin 2 could be associated with actin filaments in muscle cells more efficiently than cofilin 1. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 8ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: VGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice