125127-APC

CNKSR3 (Connector Enhancer Of Kinase Suppressor Of Ras 3, Connector Enhancer Of KSR 3, CNK Homolog Protein 3, CNK3, CNKSR Family Member 3, Maguin-like Protein, MAGI1, FLJ31349) (APC)

Größe

£927.00

SKU:: 125127-APC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa366-465 from human CNKSR3 (NP_775786) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4A11
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: CNKSR3 belongs to the CNKSR family. It contains 1 CRIC domain, 1 DUF1170 domain, 1 PDZ (DHR) domain and 1 SAM (sterile alpha motif) domain. Applications: Suitable for use in FLISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GGSSKCKQPLPGPKGSESPNSFLDQESRRRRFTIADSDQLPGYSVETNILPTKMREKTPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKGEDALCRY Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.