125101
CLTC (Clathrin Heavy Chain 1, Clathrin Heavy Chain on Chromosome 17, CLH-17, CLH17, CLTCL2, KIAA0034)
Größe
£685.00
- SKU:
- 125101
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa232-340 from human CLTC (NP_004850) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2E5
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Clathrin-coated pits, intracellular transport vesicles involved in endocytosis and other membrane trafficking processes, are multi-component units. Clathrin, the most abundant protein in these vesicles, is formed of a basic assembly unit called a triskelion composed of three clathrin heavy chains and three clathrin light chains. Together with other coat components such as AP2, epsin and EPS15, triskelia are targeted to appropriate membrane fusion sites, where subsequent invagination, cargo protein uptake and vesicle internalization occurs. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice