125101-HRP
CLTC (Clathrin Heavy Chain 1, Clathrin Heavy Chain on Chromosome 17, CLH-17, CLH17, CLTCL2, KIAA0034) (HRP)
Größe
£914.00
- SKU:
- 125101-HRP
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa232-340 from human CLTC (NP_004850) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2E5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Weitere Details:
- Clathrin-coated pits, intracellular transport vesicles involved in endocytosis and other membrane trafficking processes, are multi-component units. Clathrin, the most abundant protein in these vesicles, is formed of a basic assembly unit called a triskelion composed of three clathrin heavy chains and three clathrin light chains. Together with other coat components such as AP2, epsin and EPS15, triskelia are targeted to appropriate membrane fusion sites, where subsequent invagination, cargo protein uptake and vesicle internalization occurs. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITN Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice