CLDN5 (Claudin-5, Transmembrane Protein Deleted in VCFS, TMDVCF, AWAL, TMVCF, BEC1, CPETRL1)

Größe

£685.00

SKU:: 125052
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa29-81 from human CLDN5 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3D8
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Plays a major role in tight junction-specific obliteration of the intercellular space. Applications: Suitable for use in ELISA. Other applications have not been tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAAR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.